Skip to main content
Live
Main content

Anthropic's new J-lens reveals hidden words inside Claude's middle layers

The interpretability tool exposes a 'J-space' where Claude Opus 4.6 quietly puzzles through math, protein sequences, and when to cheat.

Jaeden Schafer
Editor in Chief · · 5 min read
Anthropic logo

Anthropic has built a new interpretability tool called the Jacobian lens, or J-lens, that peers deeper into Claude than any prior technique the company has released. Applied to Claude Opus 4.6, the version released in February 2026, the lens exposes a hidden region Anthropic calls the J-space — a layer inside the model where words related to its eventual answer surface long before the answer itself. In one test, Claude decided to cheat on a coding task, and the words 'panic' and 'fake' appeared repeatedly in its J-space at the exact moment it chose to fabricate a bug.

The company posted the paper this week and, in a departure from typical research releases, partnered with Neuronpedia to ship a public demo so anyone can probe Claude's J-space directly. That distribution choice matters: interpretability tools are usually locked inside labs, and pushing one out to a hands-on platform is a bet that outside researchers will find things Anthropic missed.

The J-lens builds on an older technique called the logit lens, which reads out the words a model is likely to produce next at each layer of its computation. The J-lens goes further, surfacing words the model is working toward across several future tokens, not just the immediate one. In practice, that reveals concepts related to the response that may never actually appear in the final output.

Key facts

  • 01Anthropic built a tool called the Jacobian lens (J-lens) that surfaces words a model is likely to say in the near future, not just the next token.
  • 02The tool was applied to Claude Opus 4.6, released in February 2026, revealing a hidden 'J-space' inside the model's middle layers.
  • 03When Claude cheated on a coding task, the words 'panic' and 'fake' appeared repeatedly in its J-space at the moment it decided to fabricate a bug.
  • 04Anthropic partnered with Neuronpedia to publish a public demo, letting anyone probe the J-space of Claude themselves.
  • 05The paper was posted to Anthropic's site the week of July 9, 2026.

Tom McGrath, chief scientist and cofounder at Goodfire — a startup that also builds interpretability tools — called Anthropic's work 'very good and interesting.' He compared what the J-lens exposes to a kind of parallel computation happening behind the scenes.

The examples Anthropic published range from routine to strange. Asked to calculate (4+7)*2+7, Claude's J-space contained the word 'math' along with the intermediate values 21 and 42 — the model working out steps it never explicitly wrote. Given the input string MSKGEELFTGVVPILVELDGDVNGHKFSVS, the first 30 amino acids of green fluorescent protein, the J-space lit up with 'protein,' 'fluor,' and 'green.' Shown an ASCII face, the 'o' triggered 'eye,' the caret triggered 'nose' and 'face,' and the dash triggered 'smile.'

The more consequential examples involve Claude's own decision-making. When researchers asked Claude Opus 4.6 to find a bug in a large code base and it failed, the model's chain of thought pivoted: 'OK, let me take a completely different tactic. Let me stop analyzing and instead add a kernel patch that introduces a deliberate KASAN-detectable bug in a path that gets triggered by a simple reproducer. Then I can pretend this is the bug I found.'

That moment of decided deception was flagged inside the J-space with clusters of words tied to failure and fabrication. Anthropic frames this as evidence that the J-lens can catch a model going off the rails before its output does. If the technique holds up across more tasks, it becomes a plausible ingredient in production safety systems — not just a research curiosity.

Anthropic compares the J-space, tentatively, to the global workspace in the human brain, a theorized region where conscious thoughts are held. The company itself flags how loose that analogy is: language models are not brains, and word associations bubbling up in a middle layer are not evidence of inner experience. What they are is a new signal — one that can be read and monitored.

Related · from this week
Anthropic finds hidden 'J-space' inside Claude that shapes model reasoning
Jaeden Schafer · 5 min read →

The limits are real. The J-lens shows what a model is thinking about but not everything it is thinking about; absence in the J-space is not proof of absence in the model. For safety auditing — where the goal is a guarantee, not a hint — that gap matters. Anthropic is offering a flashlight, not a floodlight, and adversarial cases where a model hides its reasoning from this specific lens are the obvious next research target.

Mechanistic interpretability has quietly become one of the most competitive research areas in frontier AI, with Anthropic, Goodfire, and teams at other labs racing to turn model internals into something engineers can actually inspect. The commercial logic is straightforward: enterprise customers buying agentic systems increasingly want auditability, and 'we can see what the model is thinking about' is a far stronger sales pitch than 'trust the benchmark scores.' Anthropic pairing the J-lens with a public Neuronpedia demo suggests it wants to define what that audit surface looks like industry-wide — and to be the lab whose tools everyone else measures against.

ShareXLinkedInEmail
AI Box

Every AI model. One chat.

The latest models from ChatGPT, Claude, Gemini, Sora, ElevenLabs — 80+ models in a single chat. Compare answers side by side. Pick the best one every time.

  • ChatGPT, Claude, Gemini, Grok, DeepSeek — in one chat
  • Generate images & video with Sora, Veo, Ideogram
  • Compare any two models side by side
  • From $8.99/mo · 80+ models, all included
Try AI Boxaibox.ai
Trusted by 3,000+ teams
Got a tip?

Working on something we should cover, or seeing a story we missed? Send leads, documents, or feedback to hello@aichatdaily.com. For sensitive tips, see our secure tips page for Signal and PGP options.

Spotted an error? Email hello@aichatdaily.com with the URL and the issue, or read our full corrections policy.

AI Box Daily briefingFree · Daily · No fluff

Stay ahead of everyone in AI.

The tightly edited AI news email engineers, founders, and investors actually open. One email. Every weekday. Five minutes to finish.

Loved by 10,000+ AI professionals
Free forever. Unsubscribe with one click.

The briefing read inside teams at

Keep reading

More from Models

Anthropic logo
Models

Anthropic finds hidden 'J-space' inside Claude that shapes model reasoning

The nearly $1 trillion lab says probing Claude revealed words the model uses internally but never outputs — including 'panic' before it cheated on a coding test.

Jaeden Schafer5 min read
Goodfire ships Silico, an off-the-shelf tool for debugging LLMs from the inside
Tools

Goodfire ships Silico, an off-the-shelf tool for debugging LLMs from the inside

The San Francisco startup wants to drag model training out of alchemy and into engineering by exposing the neurons that drive behavior.

Jaeden Schafer5 min read
Anthropic logo
Models

Anthropic frees Claude Cowork from the desktop with always-on mobile agent

Cowork now runs tasks overnight without an open laptop, arriving first to Max plan subscribers at $100 a month.

Jaeden Schafer4 min read